PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.413T7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 289aa    MW: 31465.5 Da    PI: 4.8171
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.413T7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.2e-124791347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
      Aradu.413T7 47 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 91
                     8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9394096IPR017930Myb domain
SuperFamilySSF466896.17E-174297IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-194395IPR006447Myb domain, plants
SMARTSM007178.0E-114494IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-114490IPR009057Homeodomain-like
CDDcd001671.81E-94792No hitNo description
PfamPF002498.6E-114791IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
PIHASGSNNP GSPGDNHDNA ATADGYASED FVPGSSSSSR ERKKGVPWTE EEHRMFLLGL  60
QKLGKGDWRG IARNYVISRT PTQVASHAQK YFIRQSNVSR RKRRSSLFDI VADEAADDTP  120
MVQQDFLSAN QLQAETEGSN PLPAVPTLDE ECESMDSTNS NDGDSVPLKP ENSQPPQQQS  180
SYPVLYPAYY SPFFPFPLPY WSGYSPEPNT VKEETHEVLK PTAVHSKAPI NVDELVGMSK  240
LSLGETIADS GPSSLSLKLQ EEGPSRQSAF HATPTCGSSN MNESAIHAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015961679.10.0PREDICTED: uncharacterized protein LOC107485662
TrEMBLA0A0S3R5R01e-174A0A0S3R5R0_PHAAN; Uncharacterized protein
STRINGGLYMA17G15330.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72303145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.16e-89MYB_related family protein